Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | WDR13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15484320
|
Novus Biologicals
NBP15484320UL |
20 μL |
Each for $152.22
|
|
NBP154843
|
Novus Biologicals
NBP154843 |
100 μL |
Each for $436.00
|
|
Description
WDR13 Polyclonal specifically detects WDR13 in Human samples. It is validated for Western Blot.Specifications
| WDR13 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q9H1Z4 | |
| 64743 | |
| Synthetic peptides corresponding to WDR13 (WD repeat domain 13) The peptide sequence was selected from the N terminal of WDR13. Peptide sequence GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp779C2057, FLJ20563, MG21, WD repeat domain 13, WD repeat-containing protein 13 | |
| WDR13 | |
| IgG | |
| Protein A purified | |
| 53 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title