Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | WDR3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179930
|
Novus Biologicals
NBP179930 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
WDR3 Polyclonal specifically detects WDR3 in Human samples. It is validated for Western Blot.Specifications
WDR3 | |
Polyclonal | |
Rabbit | |
Apoptosis | |
dJ776P7.2 (WD repeat domain 3), FLJ12796, WD repeat domain 3, WD repeat-containing protein 3 | |
WDR3 | |
IgG | |
106 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_006775 | |
10885 | |
Synthetic peptide directed towards the middle region of human WDR3The immunogen for this antibody is WDR3. Peptide sequence VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title