Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR34 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen WDR34
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155268
View Documents
Novus Biologicals
NBP155268
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

WDR34 Polyclonal specifically detects WDR34 in Human samples. It is validated for Western Blot.
Specifications

Specifications

WDR34
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
bA216B9.3, MGC20486, WD repeat domain 34, WD repeat-containing protein 34
WDR34
IgG
Affinity Purified
58 kDa
Western Blot
Unconjugated
RUO
Q96EX3
89891
Synthetic peptides corresponding to WDR34(WD repeat domain 34) The peptide sequence was selected from the C terminal of WDR34. Peptide sequence SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit