Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR34 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | WDR34 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155268
|
Novus Biologicals
NBP155268 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
WDR34 Polyclonal specifically detects WDR34 in Human samples. It is validated for Western Blot.Specifications
| WDR34 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| bA216B9.3, MGC20486, WD repeat domain 34, WD repeat-containing protein 34 | |
| WDR34 | |
| IgG | |
| Affinity Purified | |
| 58 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96EX3 | |
| 89891 | |
| Synthetic peptides corresponding to WDR34(WD repeat domain 34) The peptide sequence was selected from the C terminal of WDR34. Peptide sequence SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title