Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR51A Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen WDR51A
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123568
View Documents
Novus Biologicals
NBP30933325UL
25 μg
Each for $106.19
Add to cart
 
NB123567
View Documents
Novus Biologicals
NBP309333100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

WDR51A Polyclonal antibody specifically detects WDR51A in Rat samples. It is validated for Western Blot
Specifications

Specifications

WDR51A
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
25886
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Rat
DKFZp434C245, MGC131902, PIX2, POC1 centriolar protein homolog A, POC1 centriolar protein homolog A (Chlamydomonas), WD repeat domain 51A, WD repeat-containing protein 51A, WDR51A
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat WDR51A (NP_001102766). Peptide sequence SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit