Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR53 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen WDR53
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156804
View Documents
Novus Biologicals
NBP156804
100 μL
Each for $436.00
Add to cart
 
NBP15680420
View Documents
Novus Biologicals
NBP15680420UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

WDR53 Polyclonal specifically detects WDR53 in Human samples. It is validated for Western Blot.
Specifications

Specifications

WDR53
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
G-beta repeat-containing protein, MGC12928, MGC64882, WD repeat domain 53, WD repeat-containing protein 53
WDR53
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q7Z5U6
348793
Synthetic peptides corresponding to WDR53(WD repeat domain 53) The peptide sequence was selected from the middle region of WDR53. Peptide sequence NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit