Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR55 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | WDR55 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156385
|
Novus Biologicals
NBP156385 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
WDR55 Polyclonal specifically detects WDR55 in Human samples. It is validated for Western Blot.Specifications
| WDR55 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| Q9H6Y2 | |
| 54853 | |
| Synthetic peptides corresponding to WDR55(WD repeat domain 55) The peptide sequence was selected from the middle region of WDR55. Peptide sequence AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ20195, FLJ21702, WD repeat domain 55, WD repeat-containing protein 55 | |
| WDR55 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title