Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen WDR6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15484420
View Documents
Novus Biologicals
NBP15484420UL
20 μL
Each for $152.22
Add to cart
 
NBP154844
View Documents
Novus Biologicals
NBP154844
100 μL
Each for $436.00
Add to cart
 
Description

Description

WDR6 Polyclonal specifically detects WDR6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

WDR6
Polyclonal
Rabbit
Q6AZD6
11180
Synthetic peptides corresponding to WDR6 (WD repeat domain 6) The peptide sequence was selected from the C terminal of WDR6. Peptide sequence TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
FLJ10218, FLJ52552, FLJ56107, MGC126756, MGC142027, WD repeat domain 6, WD repeat-containing protein 6
WDR6
IgG
Affinity Purified
53 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit