Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR63 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | WDR63 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156718
|
Novus Biologicals
NBP156718 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
WDR63 Polyclonal specifically detects WDR63 in Human samples. It is validated for Western Blot.Specifications
| WDR63 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ30067, NYD-SP29, RP11-507C22.2, Testis development protein NYD-SP29, testis development protein NYD-SP29 (NYD-SP29), WD repeat domain 63, WD repeat-containing protein 63 | |
| WDR63 | |
| IgG | |
| Affinity Purified | |
| 103 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IWG1 | |
| 126820 | |
| Synthetic peptides corresponding to WDR63(WD repeat domain 63) The peptide sequence was selected from the middle region of WDR63. Peptide sequence EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title