Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR73 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | WDR73 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179863
|
Novus Biologicals
NBP179863 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
WDR73 Polyclonal specifically detects WDR73 in Human samples. It is validated for Western Blot.Specifications
| WDR73 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ00296 protein, FLJ14888, HSPC264, WD repeat domain 73, WD repeat-containing protein 73 | |
| WDR73 | |
| IgG | |
| Affinity Purified | |
| 42 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_116245 | |
| 84942 | |
| Synthetic peptide directed towards the middle region of human WDR73The immunogen for this antibody is WDR73. Peptide sequence VVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKW. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title