Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR73 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen WDR73
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179863
View Documents
Novus Biologicals
NBP179863
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

WDR73 Polyclonal specifically detects WDR73 in Human samples. It is validated for Western Blot.
Specifications

Specifications

WDR73
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ00296 protein, FLJ14888, HSPC264, WD repeat domain 73, WD repeat-containing protein 73
WDR73
IgG
Affinity Purified
42 kDa
Western Blot
Unconjugated
RUO
NP_116245
84942
Synthetic peptide directed towards the middle region of human WDR73The immunogen for this antibody is WDR73. Peptide sequence VVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKW.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit