Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR78 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | WDR78 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124717
|
Novus Biologicals
NBP309908100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
WDR78 Polyclonal specifically detects WDR78 in Human samples. It is validated for Western Blot.Specifications
WDR78 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
WD repeat domain 78 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR78. Peptide sequence VMVSVESEEAEKVTQRNKNYEVLCRNRLGNDLYVERMMQTFNGAPKNKDV | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
79819 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title