Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15477620UL

 View more versions of this product

Catalog No. NBP15477620


Add to cart

Description

Description

WDR8 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

WDR8
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
WRAP73
Synthetic peptides corresponding to WDR8(WD repeat domain 8) The peptide sequence was selected from the middle region of WDR8. Peptide sequence GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML.
51 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
Q9P2S5
FLJ20430, MGC99569, WD repeat domain 8, WD repeat-containing protein 8
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
49856
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit