Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | WDR8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154776
|
Novus Biologicals
NBP154776 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
WDR8 Polyclonal specifically detects WDR8 in Human samples. It is validated for Western Blot.Specifications
| WDR8 | |
| Polyclonal | |
| Rabbit | |
| Q9P2S5 | |
| 49856 | |
| Synthetic peptides corresponding to WDR8(WD repeat domain 8) The peptide sequence was selected from the middle region of WDR8. Peptide sequence GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ20430, MGC99569, WD repeat domain 8, WD repeat-containing protein 8 | |
| WRAP73 | |
| IgG | |
| Affinity Purified | |
| 51 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title