WDR89 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156333

Catalog No. NBP156333

Description

WDR89 Polyclonal specifically detects WDR89 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: WDR89
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96FK6
• Gene Symbols: WDR89
• Immunogen: Synthetic peptides corresponding to WDR89(WD repeat domain 89) The peptide sequence was selected from the middle region of WDR89. Peptide sequence TVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Xenopus: 91%; Mouse: 85%; Rat: 84%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C14orf150, MGC9907, WD repeat domain 89, WD repeat-containing protein 89
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 112840
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.