Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR89 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | WDR89 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156333
|
Novus Biologicals
NBP156333 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
WDR89 Polyclonal specifically detects WDR89 in Human samples. It is validated for Western Blot.Specifications
WDR89 | |
Polyclonal | |
Rabbit | |
Q96FK6 | |
112840 | |
Synthetic peptides corresponding to WDR89(WD repeat domain 89) The peptide sequence was selected from the middle region of WDR89. Peptide sequence TVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C14orf150, MGC9907, WD repeat domain 89, WD repeat-containing protein 89 | |
WDR89 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title