Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | WDR9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WDR9 Polyclonal specifically detects WDR9 in Human samples. It is validated for Western Blot.Specifications
WDR9 | |
Polyclonal | |
Rabbit | |
Q6P2D1 | |
54014 | |
Synthetic peptides corresponding to BRWD1(bromodomain and WD repeat domain containing 1) The peptide sequence was selected from the N terminal of BRWD1. Peptide sequence MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
bromodomain and WD repeat domain containing 1, bromodomain and WD repeat-containing protein 1, C21orf107, chromosome 21 open reading frame 107, FLJ11315, FLJ43918, N143, transcriptional unit N143, WD repeat domain 9, WD repeat protein WDR9-form2, WD repeat-containing protein 9, WDR9 | |
BRWD1 | |
IgG | |
13 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title