Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154801

 View more versions of this product

Catalog No. NBP154801


Add to cart

Description

Description

WDR9 Polyclonal antibody specifically detects WDR9 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig samples. It is validated for Western Blot.
Specifications

Specifications

WDR9
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
BRWD1
Synthetic peptides corresponding to BRWD1(bromodomain and WD repeat domain containing 1) The peptide sequence was selected from the N terminal of BRWD1. Peptide sequence MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK.
13 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Canine: 86%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat
Western Blot
Western Blot 1:100-1:2000
Q6P2D1
bromodomain and WD repeat domain containing 1, bromodomain and WD repeat-containing protein 1, C21orf107, chromosome 21 open reading frame 107, FLJ11315, FLJ43918, N143, transcriptional unit N143, WD repeat domain 9, WD repeat protein WDR9-form2, WD repeat-containing protein 9, WDR9
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
54014
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit