Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDSUB1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15507320UL

 View more versions of this product

Catalog No. NBP15507320


Add to cart

Description

Description

WDSUB1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

WDSUB1
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
WDSUB1
Synthetic peptides corresponding to WDSUB1(WD repeat, sterile alpha motif and U-box domain containing 1) The peptide sequence was selected from the middle region of WDSUB1. Peptide sequence KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRT
53 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
Q8N9V3
FLJ36175,2610014F08Rik, SAM and U-box domain-containing protein 1, UBOX6, WD repeat, SAM and U-box domain containing 1, WD repeat, sterile alpha motif and U-box domain containing 1, WDSAM1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
151525
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit