WFDC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157714

Catalog No. NBP157714

Description

WFDC1 Polyclonal specifically detects WFDC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: WFDC1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9HC57
• Gene Symbols: WFDC1
• Immunogen: Synthetic peptides corresponding to WFDC1 (WAP four-disulfide core domain 1) The peptide sequence was selected from the middle region of WFDC1)(50ug). Peptide sequence VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Pig: 84%.
• Target Species: Human, Rat, Porcine, Canine
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ps20 growth inhibitor, PS20Prostate stromal protein ps20, WAP four-disulfide core domain 1, WAP four-disulfide core domain 1 homolog, WAP four-disulfide core domain protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 58189
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.