Abnova™ WFDC2 Recombinant Protein

Human full-length ORF recombinant protein with GST-tag at N-terminal

Catalog Number	Mfr. No.	Quantity
89-011-876	Abnova™ H00010406P0110	10 ug
89-011-877	Abnova™ H00010406P0125	25 ug

Description

• Encoded by WAP four-disulfide core domain 2
• Molecular weight: 36.08kDa
• Preparation method: in vitro wheat germ expression system
• Purification: glutathione sepharose 4 fast flow
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
• pH=8.0 in elution buffer

Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Best when used within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH46106.1
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Molecular Weight (g/mol): 36.08
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Source: Wheat Germ (in vitro)
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: WFDC2
• Cross Reactivity: Human
• Recombinant: Recombinant
• Form: Solution

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 10406
• Name: WFDC2 (Human) Recombinant Protein (P01)
• Preparation Method: In vitro wheat germ expression system
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
• Gene Alias: HE4/MGC57529/WAP5/dJ461P17.6
• Gene Symbol: WFDC2
• Species: Wheat Germ (in vitro)
• Protein Tag: GST