Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WIPF1/WIP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen WIPF1/WIP
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124824
View Documents
Novus Biologicals
NBP30996125UL
25 μg
Each for $106.19
Add to cart
 
NB124823
View Documents
Novus Biologicals
NBP309961100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

WIPF1/WIP Polyclonal antibody specifically detects WIPF1/WIP in Human samples. It is validated for Western Blot
Specifications

Specifications

WIPF1/WIP
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
7456
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
WAS/WASL interacting protein family, member 1, WAS/WASL-interacting protein family member 1, WASP-interacting protein, WASPIP, WIPMGC111041, WiskProtein PRPL-2, WiskPRPL-2
The immunogen is a synthetic peptide directed towards the middle region of human WIPF1/WIP (NP_001070737.1). Peptide sequence PFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit