Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WNK3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen WNK3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158361
View Documents
Novus Biologicals
NBP158361
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

WNK3 Polyclonal specifically detects WNK3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

WNK3
Polyclonal
Rabbit
Protein Kinase
Q9BYP7
65267
Synthetic peptides corresponding to WNK3(WNK lysine deficient protein kinase 3) The peptide sequence was selected from the N terminal of WNK3. Peptide sequence WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.7.11, FLJ30437, KIAA1566FLJ42662, PRKWNK3lysine deficient 3, WNK lysine deficient protein kinase 3
WNK3
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit