Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WNK3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | WNK3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158361
|
Novus Biologicals
NBP158361 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
WNK3 Polyclonal specifically detects WNK3 in Human samples. It is validated for Western Blot.Specifications
| WNK3 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| Q9BYP7 | |
| 65267 | |
| Synthetic peptides corresponding to WNK3(WNK lysine deficient protein kinase 3) The peptide sequence was selected from the N terminal of WNK3. Peptide sequence WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.7.11, FLJ30437, KIAA1566FLJ42662, PRKWNK3lysine deficient 3, WNK lysine deficient protein kinase 3 | |
| WNK3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title