Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Wnt-1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | Wnt-1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126749
|
Novus Biologicals
NBP310925100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
Wnt-1 Polyclonal specifically detects Wnt-1 in Mouse samples. It is validated for Western Blot.Specifications
Wnt-1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Apoptosis, Breast Cancer, Cellular Markers, Oncogenes, Stem Cell Signaling Pathway, Wnt Signaling Pathway | |
PBS buffer, 2% sucrose | |
7471 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Mouse | |
INT1Proto-oncogene Int-1 homolog, proto-oncogene Wnt-1, wingless-type MMTV integration site family, member 1, wingless-type MMTV integration site family, member 1 (oncogene INT1) | |
The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Wnt-1 (NP_067254). Peptide sequence NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title