Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WWP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen WWP2
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126029
View Documents
Novus Biologicals
NBP310564100UL
100 μg
Each for $320.71
Add to cart
 
NB126030
View Documents
Novus Biologicals
NBP31056425UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

WWP2 Polyclonal antibody specifically detects WWP2 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

WWP2
Western Blot, Immunohistochemistry
Purified
RUO
PBS buffer, 2% sucrose
11060
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Human
AIP2Nedd-4-like ubiquitin-protein ligase, atrophin-1 interacting protein 2, Atrophin-1-interacting protein 2, EC 6.3.2, EC 6.3.2.-, NEDD4-like E3 ubiquitin-protein ligase WWP2, WW domain containing E3 ubiquitin protein ligase 2, WW domain-containing protein 2, WWp2-like
The immunogen is a synthetic peptide directed towards the middle region of human WWP2 (NP_955456). Peptide sequence EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit