Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WWP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15308920UL

 View more versions of this product

Catalog No. NBP15308920


Add to cart

Description

Description

WWP2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

WWP2
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
WWP2
Synthetic peptides corresponding to WWP2(WW domain containing E3 ubiquitin protein ligase 2) The peptide sequence was selected from the middle region of WWP2. Peptide sequence SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP.
Immunogen affinity purified
RUO
Primary
11060
Western Blot
Western Blot 1:100-1:2000
O00308
AIP2Nedd-4-like ubiquitin-protein ligase, atrophin-1 interacting protein 2, Atrophin-1-interacting protein 2, EC 6.3.2, EC 6.3.2.-, NEDD4-like E3 ubiquitin-protein ligase WWP2, WW domain containing E3 ubiquitin protein ligase 2, WW domain-containing protein 2, WWp2-like
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit