Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

XPB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen XPB
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125836
View Documents
Novus Biologicals
NBP31046725UL
25 μg
Each for $106.19
Add to cart
 
NB125835
View Documents
Novus Biologicals
NBP310467100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

XPB Polyclonal antibody specifically detects XPB in Human samples. It is validated for Western Blot
Specifications

Specifications

XPB
Western Blot
Purified
RUO
Human
Basic transcription factor 2 89 kDa subunit, BTF2, BTF2 p89, DNA excision repair protein ERCC-3, DNA repair protein complementing XP-B cells, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing), GTF2H, RAD25, TFIIH, TFIIH basal transcription factor complex 89 kDa subunit, TFIIH basal transcription factor complex helicase XPB subunit, TFIIH p89, Xeroderma pigmentosum group B-complementing protein, xeroderma pigmentosum, complementation group B, XPBC, XPBTFIIH 89 kDa subunit
The immunogen is a synthetic peptide directed towards the N terminal region of human XPB (NP_000113). Peptide sequence MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Cancer, DNA Repair, Nucleotide Excision Repair
PBS buffer, 2% sucrose
2071
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit