XRCC5 Recombinant Protein, Abnova Available on GSA/VA Contract for Federal Government customers only.

Human XRCC5 full-length ORF recombinant protein with GST-tag at N-terminal

Manufacturer: Abnova Corporation H00007520P0125

 View more versions of this product

Catalog No. 89-011-091

  Check Availability
Add to Cart

    Specifications

    Cross Reactivity Human
    For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein)
    Format Solution
    Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
    Molecular Weight 106.26
    Name Human XRCC5 Full-length ORF Recombinant Protein with GST-tag at N-terminal
    pH Range 8
    Preparation Method In vitro wheat germ expression system
    Purification Method Glutathione Sepharose 4 Fast Flow
    Quality Control Testing 12.5% SDS-PAGE stained with Coomassie Blue
    Quantity 25μg
    Recombinant Yes
    Source Wheat Germ (in vitro)
    Storage Requirements -80°C

    The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.

    • Theoretical MW (kDa): 106.26
    • Preparation method: In vitro wheat germ expression system
    • Purification: Glutathione Sepharose 4 fast flow
    • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

    Sequence: MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADSLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGIALITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI

    Best use within three months from the date of receipt of this protein.

    ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit