Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
XTP3TPA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15533520UL
Description
XTP3TPA Polyclonal specifically detects XTP3TPA in Human samples. It is validated for Western Blot.Specifications
XTP3TPA | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9H773 | |
DCTPP1 | |
Synthetic peptides corresponding to XTP3TPA(XTP3-transactivated protein A) The peptide sequence was selected from the N terminal of XTP3TPA. Peptide sequence MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF. | |
Protein A purified | |
RUO | |
79077 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dCTP pyrophosphatase 1, dCTPase 1, Deoxycytidine-triphosphatase 1, EC 3.6.1.12, MGC5627, RS21C6XTP3-transactivated gene A protein, XTP3TPACDA03, XTP3-transactivated protein A | |
Rabbit | |
19 kDa | |
20 μL | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction