Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

XTP3TPA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen XTP3TPA
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15533520
View Documents
Novus Biologicals
NBP15533520UL
20 μL
Each for $152.22
Add to cart
 
NBP155335
View Documents
Novus Biologicals
NBP155335
100 μL
Each for $436.00
Add to cart
 
Description

Description

XTP3TPA Polyclonal specifically detects XTP3TPA in Human samples. It is validated for Western Blot.
Specifications

Specifications

XTP3TPA
Polyclonal
Purified
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
dCTP pyrophosphatase 1, dCTPase 1, Deoxycytidine-triphosphatase 1, EC 3.6.1.12, MGC5627, RS21C6XTP3-transactivated gene A protein, XTP3TPACDA03, XTP3-transactivated protein A
DCTPP1
IgG
Protein A purified
19 kDa
Western Blot
Unconjugated
Rabbit
Human
Q9H773
79077
Synthetic peptides corresponding to XTP3TPA(XTP3-transactivated protein A) The peptide sequence was selected from the N terminal of XTP3TPA. Peptide sequence MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit