Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
XTP3TPA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | XTP3TPA |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15533520
|
Novus Biologicals
NBP15533520UL |
20 μL |
Each for $152.22
|
|
NBP155335
|
Novus Biologicals
NBP155335 |
100 μL |
Each for $436.00
|
|
Description
XTP3TPA Polyclonal specifically detects XTP3TPA in Human samples. It is validated for Western Blot.Specifications
XTP3TPA | |
Polyclonal | |
Purified | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dCTP pyrophosphatase 1, dCTPase 1, Deoxycytidine-triphosphatase 1, EC 3.6.1.12, MGC5627, RS21C6XTP3-transactivated gene A protein, XTP3TPACDA03, XTP3-transactivated protein A | |
DCTPP1 | |
IgG | |
Protein A purified | |
19 kDa |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
Q9H773 | |
79077 | |
Synthetic peptides corresponding to XTP3TPA(XTP3-transactivated protein A) The peptide sequence was selected from the N terminal of XTP3TPA. Peptide sequence MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title