YB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258086

Catalog No. NBP258086

Description

YB1 Polyclonal specifically detects YB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: YB1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-binding protein 1, Y box binding protein 1, YB1 DNA-binding protein B, YB-1 Y-box transcription factor, YBX1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: YBX1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ
• Quantity: 100 μL
• Research Discipline: Breast Cancer, Cancer, DNA Repair, Epigenetics, Ovarian Carcinoma Cell Markers, Stem Cell Markers, Transcription Factors and Regulators, Translation Control
• Gene ID (Entrez): 4904
• Target Species: Human
• Isotype: IgG

For Research Use Only