Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
YIF1B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | YIF1B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159926
|
Novus Biologicals
NBP159926 |
100 μL |
Each of 1 for $436.00
|
|
Description
YIF1B Polyclonal specifically detects YIF1B in Human samples. It is validated for Western Blot.Specifications
YIF1B | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
90522 | |
Synthetic peptides corresponding to YIF1B(Yip1 interacting factor homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of YIF1B. Peptide sequence LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
FinGER8, FLJ23477, FLJ50074, MGC39135, protein YIF1B, Yip1 interacting factor homolog B (S. cerevisiae), YIP1-interacting factor homolog B | |
YIF1B | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title