Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

YIPF5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP259007

Catalog No. NBP259007


Add to cart

Description

Description

YIPF5 Polyclonal antibody specifically detects YIPF5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

YIPF5
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
FinGER5, Golgi Membrane Protein SB140, Protein YIPF5, SB140, SMAP5, SMAP-5, Smooth Muscle Cell Associated Protein 5, Smooth Muscle Cell-Associated Protein 5, Yip1 Domain Family Member 5, Yip1 Domain Family, Member 5, YIP1 Family Member 5, YIP1A, YPT-Interacting Protein 1 A
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
YIPF5
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLE
Affinity purified
RUO
Primary
81555
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only