Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ymer Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153104

 View more versions of this product

Catalog No. NBP153104

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

Ymer Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

Ymer
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CCDC50
Synthetic peptides corresponding to CCDC50(coiled-coil domain containing 50) The peptide sequence was selected from the middle region of CCDC50 (NP_848018). Peptide sequence GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV.
56 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Zebrafish: 77%.
Human
Western Blot
Western Blot 0.2-1 ug/ml
Q8IVM0
C3orf6deafness, autosomal dominant 44, coiled-coil domain containing 50, coiled-coil domain-containing protein 50, DFNA44, Protein Ymer, YMER
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
152137
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit