Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZBTB22 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180113

 View more versions of this product

Catalog No. NBP180113

Add to cart



ZBTB22 Polyclonal antibody specifically detects ZBTB22 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig samples. It is validated for Western Blot.


PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the C terminal of human ZBTB22. Peptide sequence MQGNQILVFPSSSSSSSSQAPGQPPGNQAEHGAVTVGGTSVGSLGVPGSV.
66 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
BING1ZNF297, fru, fruitless, Protein BING1, ZBTB22AZNF297A, zinc finger and BTB domain containing 22, zinc finger and BTB domain-containing protein 22, Zinc finger protein 297Zinc finger and BTB domain-containing protein 22A
Immunogen affinity purified
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit