Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBTB26 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZBTB26 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180350
|
Novus Biologicals
NBP180350 |
100 μL |
Each of 1 for $436.00
|
|
Description
ZBTB26 Polyclonal specifically detects ZBTB26 in Human samples. It is validated for Western Blot.Specifications
ZBTB26 | |
Polyclonal | |
Rabbit | |
NP_065975 | |
57684 | |
Synthetic peptide directed towards the N terminal of human ZBTB26. Peptide sequence MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
KIAA1572, zinc finger and BTB domain containing 26, zinc finger and BTB domain-containing protein 26, Zinc finger protein 481bioref, zinc finger protein 483, Zinc finger protein Bioref, ZNF481 | |
ZBTB26 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title