Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZBTB26 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18035120UL

 View more versions of this product

Catalog No. NBP1803520


Add to cart

Description

Description

ZBTB26 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ZBTB26
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
ZBTB26
Synthetic peptide directed towards the C terminal of human ZBTB26. Peptide sequence VFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGC.
Immunogen affinity purified
RUO
Primary
57684
Western Blot
Western Blot 1:1000
NP_065975
KIAA1572, zinc finger and BTB domain containing 26, zinc finger and BTB domain-containing protein 26, Zinc finger protein 481bioref, zinc finger protein 483, Zinc finger protein Bioref, ZNF481
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit