Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBTB38 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$436.00
Specifications
| Antigen | ZBTB38 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180263
|
Novus Biologicals
NBP180263 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZBTB38 Polyclonal specifically detects ZBTB38 in Mouse samples. It is validated for Western Blot.Specifications
| ZBTB38 | |
| Polyclonal | |
| Rabbit | |
| NP_780746 | |
| 253461 | |
| Synthetic peptide directed towards the N terminal of human ZBTB38. Peptide sequence EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CIBZ, FLJ22332, FLJ31131, FLJ35036, zinc finger and BTB domain containing 38, zinc finger and BTB domain-containing protein 38, ZNF921 | |
| ZBTB38 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title