Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZBTB5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen ZBTB5
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124888
View Documents
Novus Biologicals
NBP30999325UL
25 μg
Each for $106.19
Add to cart
 
NB124887
View Documents
Novus Biologicals
NBP309993100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

ZBTB5 Polyclonal antibody specifically detects ZBTB5 in Human samples. It is validated for Western Blot
Specifications

Specifications

ZBTB5
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
9925
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
KIAA0354, zinc finger and BTB domain containing 5, zinc finger and BTB domain-containing protein 5
The immunogen is a synthetic peptide directed towards the middle region of human ZBTB5 (NP_055687.1). Peptide sequence HILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNNDDNIPNTTSDCRLES
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit