Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZBTB7C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191522

 View more versions of this product

Catalog No. NBP191522

Add to cart



ZBTB7C Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptide directed towards the N terminal of human ZBTB7C. Peptide sequence MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS.
69 kDa
Store at -20C. Avoid freeze-thaw cycles.
Zebrafish: 92%.
Western Blot
Western Blot 1:1000
affected by papillomavirus DNA integration in ME180 cells protein 1, APM1, APM-1, B230208J24Rik, FLJ37907, ZBTB36, zinc finger and BTB domain containing 36, zinc finger and BTB domain containing 7C, zinc finger and BTB domain-containing protein 36, zinc finger and BTB domain-containing protein 7C, zinc finger protein 857C, ZNF857C
Protein A purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit