Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZBTB7C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19152220UL

 View more versions of this product

Catalog No. NBP19152220


Add to cart

Description

Description

ZBTB7C Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ZBTB7C
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
ZBTB7C
Synthetic peptide directed towards the N terminal of human ZBTB7C. Peptide sequence MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS.
69 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_001034449
affected by papillomavirus DNA integration in ME180 cells protein 1, APM1, APM-1, B230208J24Rik, FLJ37907, ZBTB36, zinc finger and BTB domain containing 36, zinc finger and BTB domain containing 7C, zinc finger and BTB domain-containing protein 36, zinc finger and BTB domain-containing protein 7C, zinc finger protein 857C, ZNF857C
Rabbit
IgG
Protein A purified
RUO
Primary
201501
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit