Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBTB7C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | ZBTB7C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19152220
|
Novus Biologicals
NBP19152220UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP191522
|
Novus Biologicals
NBP191522 |
100 μL |
Each for $482.50
|
|
|||||
Description
ZBTB7C Polyclonal specifically detects ZBTB7C in Human samples. It is validated for Western Blot.Specifications
| ZBTB7C | |
| Polyclonal | |
| Purified | |
| RUO | |
| affected by papillomavirus DNA integration in ME180 cells protein 1, APM1, APM-1, B230208J24Rik, FLJ37907, ZBTB36, zinc finger and BTB domain containing 36, zinc finger and BTB domain containing 7C, zinc finger and BTB domain-containing protein 36, zinc finger and BTB domain-containing protein 7C, zinc finger protein 857C, ZNF857C | |
| ZBTB7C | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_001034449 | |
| 201501 | |
| Synthetic peptide directed towards the N terminal of human ZBTB7C. Peptide sequence MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS. | |
| Primary | |
| 69 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title