Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZC2HC1B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | ZC2HC1B |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB123493
|
Novus Biologicals
NBP309296100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
ZC2HC1B Polyclonal specifically detects ZC2HC1B in Human samples. It is validated for Western Blot.Specifications
| ZC2HC1B | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| chromosome 6 open reading frame 94, dJ468K18.5, FAM164B, family with sequence similarity 164, member B, hypothetical protein LOC153918 | |
| The immunogen is a synthetic peptide directed towards the middle region of human ZC2HC1B (XP_946358). Peptide sequence EPTVTSAVGALLQNRVLVATNEVPTKSGLAMDPASGAKLRQGFSKSSKKD | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 153918 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title