ZC3H3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174066

Catalog No. NBP174066

Description

ZC3H3 Polyclonal specifically detects ZC3H3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ZC3H3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8CHP0
• Gene Symbols: ZC3H3
• Immunogen: Synthetic peptides corresponding to the N terminal of Zc3h3. Immunizing peptide sequence KEQLRRQIRLLQGLIDDYKTLHGNGPALGNSSATRWQPPMFPGGRTFGAR.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23144
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0150zinc finger CCCH-type domain containing 3, ZC3HDC3, zinc finger CCCH domain-containing protein 3, zinc finger CCCH type domain containing 3, zinc finger CCCH-type containing 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 105 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 86%; Guinea pig: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig
• Isotype: IgG