Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZC3H3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP174066
Description
ZC3H3 Polyclonal specifically detects ZC3H3 in Mouse samples. It is validated for Western Blot.Specifications
ZC3H3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
KIAA0150zinc finger CCCH-type domain containing 3, ZC3HDC3, zinc finger CCCH domain-containing protein 3, zinc finger CCCH type domain containing 3, zinc finger CCCH-type containing 3 | |
Rabbit | |
105 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Pig: 86%; Guinea pig: 86%. | |
Human, Mouse, Rat, Bovine, Equine, Guinea Pig | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8CHP0 | |
ZC3H3 | |
Synthetic peptides corresponding to the N terminal of Zc3h3. Immunizing peptide sequence KEQLRRQIRLLQGLIDDYKTLHGNGPALGNSSATRWQPPMFPGGRTFGAR. | |
Affinity purified | |
RUO | |
23144 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction