Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZC3H3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZC3H3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174066
|
Novus Biologicals
NBP174066 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZC3H3 Polyclonal specifically detects ZC3H3 in Mouse samples. It is validated for Western Blot.Specifications
| ZC3H3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| KIAA0150zinc finger CCCH-type domain containing 3, ZC3HDC3, zinc finger CCCH domain-containing protein 3, zinc finger CCCH type domain containing 3, zinc finger CCCH-type containing 3 | |
| ZC3H3 | |
| IgG | |
| Affinity Purified | |
| 105 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8CHP0 | |
| 23144 | |
| Synthetic peptides corresponding to the N terminal of Zc3h3. Immunizing peptide sequence KEQLRRQIRLLQGLIDDYKTLHGNGPALGNSSATRWQPPMFPGGRTFGAR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title