Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZCCHC12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15480820UL

 View more versions of this product

Catalog No. NBP15480820


Add to cart

Description

Description

ZCCHC12 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ZCCHC12
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ZCCHC12
Synthetic peptides corresponding to ZCCHC12(zinc finger, CCHC domain containing 12) The peptide sequence was selected from the N terminal of ZCCHC12. Peptide sequence AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE.
45 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
Q6PEW1
FLJ16123, SIZN, SIZN12810028A01Rik, Smad-interacting zinc finger protein 1, zinc finger CCHC domain-containing protein 12, zinc finger, CCHC domain containing 12
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
170261
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit