ZCCHC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179404

Catalog No. NBP179404

Description

ZCCHC3 Polyclonal specifically detects ZCCHC3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZCCHC3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_149080
• Gene Symbols: ZCCHC3
• Immunogen: Synthetic peptide directed towards the middle region of human ZCCHC3The immunogen for this antibody is ZCCHC3. Peptide sequence RDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALFLRVYE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C20orf99, chromosome 20 open reading frame 99, dJ1103G7.7, MGC104290, zinc finger CCHC domain-containing protein 3, zinc finger, CCHC domain containing 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 85364
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.