Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZDHHC11/ZDHHC11B Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17932720UL

 View more versions of this product

Catalog No. NBP17932720


Add to cart

Description

Description

ZDHHC11/ZDHHC11B Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.
Specifications

Specifications

ZDHHC11/ZDHHC11B
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ZDHHC11B
The immunogen for this antibody is Zdhhc11 (NP_001034431). Peptide sequence TIDPADTNVRLKKDYLEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHC.
42 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Rat
Western Blot
Western Blot 1 ug/ml
P0C7U3
DHHC-11B, ZDHHC11B, zinc finger, DHHC-type containing 11B
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
653082
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit