Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZDHHC13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	ZDHHC13
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15902620 View Documents View Product Certificates	Novus Biologicals NBP15902620UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159026 View Documents View Product Certificates	Novus Biologicals NBP159026	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ZDHHC13 Polyclonal specifically detects ZDHHC13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	ZDHHC13
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	Q8IUH4-3
Gene ID (Entrez)	54503
Immunogen	Synthetic peptides corresponding to ZDHHC13(zinc finger, DHHC-type containing 13) The peptide sequence was selected from the N terminal of ZDHHC13. Peptide sequence MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV.
Primary or Secondary	Primary

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Signal Transduction
Gene Alias	DHHC-13, EC 2.3.1, EC 2.3.1.-, FLJ10852, FLJ10941, HIP14LHIP14-related protein, HIP3RP, huntingtin interacting protein HIP3RP, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, MGC64994, palmitoyltransferase ZDHHC13, probable palmitoyltransferase ZDHHC13, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DHHC domain-containing protein 13, zinc finger, DHHC domain containing 13, zinc finger, DHHC-type containing 13
Gene Symbols	ZDHHC13
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ZDHHC13 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents