Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZDHHC13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ZDHHC13 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15902620
|
Novus Biologicals
NBP15902620UL |
20 μL |
Each for $152.22
|
|
NBP159026
|
Novus Biologicals
NBP159026 |
100 μL |
Each for $436.00
|
|
Description
ZDHHC13 Polyclonal specifically detects ZDHHC13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ZDHHC13 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DHHC-13, EC 2.3.1, EC 2.3.1.-, FLJ10852, FLJ10941, HIP14LHIP14-related protein, HIP3RP, huntingtin interacting protein HIP3RP, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, MGC64994, palmitoyltransferase ZDHHC13, probable palmitoyltransferase ZDHHC13, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DHHC domain-containing protein 13, zinc finger, DHHC domain containing 13, zinc finger, DHHC-type containing 13 | |
| ZDHHC13 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| Q8IUH4-3 | |
| 54503 | |
| Synthetic peptides corresponding to ZDHHC13(zinc finger, DHHC-type containing 13) The peptide sequence was selected from the N terminal of ZDHHC13. Peptide sequence MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title