Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals ZDHHC14 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Manufacturer: Novus Biologicals NBP257173PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZDHHC14. Source: E.coli Amino Acid Sequence: FTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMCDQDQCIQSTKFV The ZDHHC14 Recombinant Protein Antigen is derived from E. coli. The ZDHHC14 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
Blocking/Neutralizing, Control | |
79683 | |
>80% by SDS-PAGE and Coomassie blue staining | |
E.coli | |
RUO | |
ZDHHC14 | |
Unlabeled | |
Yes |
PBS and 1M Urea, pH 7.4. | |
ZDHHC14 Recombinant Protein Antigen | |
100μL | |
Store at −20°C. Avoid freeze-thaw cycles. | |
DHHC domain containing 14, DHHC-14, EC 2.3.1, EC 2.3.1.-, NEW1 domain-containing protein, zinc finger, DHHC-type containing 14 | |
Recombinant Protein Antigen | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only.